Lineage for d4kqrb1 (4kqr B:53-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004526Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 3004527Protein automated matches [226981] (13 species)
    not a true protein
  7. 3004559Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [228776] (27 PDB entries)
  8. 3004574Domain d4kqrb1: 4kqr B:53-221 [235215]
    Other proteins in same PDB: d4kqra2, d4kqrb2
    automated match to d4kqoa1
    complexed with cl, gol, imd, vpp

Details for d4kqrb1

PDB Entry: 4kqr (more details), 2.01 Å

PDB Description: crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with (5s)-penicilloic acid
PDB Compounds: (B:) penicillin-binding protein 3

SCOPe Domain Sequences for d4kqrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kqrb1 d.175.1.0 (B:53-221) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfad
rieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvdd
rgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

SCOPe Domain Coordinates for d4kqrb1:

Click to download the PDB-style file with coordinates for d4kqrb1.
(The format of our PDB-style files is described here.)

Timeline for d4kqrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kqrb2