Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) automatically mapped to Pfam PF03717 |
Family d.175.1.0: automated matches [227232] (1 protein) not a true family |
Protein automated matches [226981] (13 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [228776] (27 PDB entries) |
Domain d4kqrb1: 4kqr B:53-221 [235215] Other proteins in same PDB: d4kqra2, d4kqrb2 automated match to d4kqoa1 complexed with cl, gol, imd, vpp |
PDB Entry: 4kqr (more details), 2.01 Å
SCOPe Domain Sequences for d4kqrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kqrb1 d.175.1.0 (B:53-221) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} vrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfad rieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvdd rgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal
Timeline for d4kqrb1: