SCOPe 2.08: Domain d4knsa2: 4kns A:154-309

Lineage for d4knsa2 (4kns A:154-309)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries)

8. Domain d4knsa2: 4kns A:154-309 [235199]
   automated match to d1kbva2
   complexed with cl, cu, gol

Details for d4knsa2

PDB Entry: 4kns, 2.2 Å

PDB Description: Reduced crystal structure of the Nitrosomonas europaea copper nitrite reductase at pH 6.5

PDB Compounds: (A:) Multicopper oxidase type 1

SCOPe Domain Sequences for d4knsa2:

Sequence; same for both SEQRES and ATOM records:

>d4knsa2 b.6.1.0 (A:154-309) automated matches {Nitrosomonas europaea [TaxId: 228410]}
dreyvliqaehyenpddktammqnkwsnvvfnggvfkydpvhdseatswlqakpgervri
yfvnagpnelsslhpiagiwdrvypsgnpknvqyalqsyligagdaatldlispvegana
ivdhsmrhahsgaiavimftndadpeagrgenilir

Timeline for d4knsa2:

• d4knsa2 first appeared in SCOPe 2.03
  
• d4knsa2 appears in SCOPe 2.07