SCOPe 2.08: Domain d4kl9a1: 4kl9 A:1-159

Lineage for d4kl9a1 (4kl9 A:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [230073] (6 PDB entries)

8. Domain d4kl9a1: 4kl9 A:1-159 [235182]
   Other proteins in same PDB: d4kl9a2
   automated match to d4klxb_
   complexed with ndp, p33

Details for d4kl9a1

PDB Entry: 4kl9, 1.39 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium tuberculosis in the space group c2

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4kl9a1:

Sequence; same for both SEQRES and ATOM records:

>d4kl9a1 c.71.1.0 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d4kl9a1:

• d4kl9a1 first appeared in SCOPe 2.03, called d4kl9a_
  
• d4kl9a1 appears in SCOPe 2.07