SCOPe 2.03: Domain d1rvf3_: 1rvf 3:

Lineage for d1rvf3_ (1rvf 3:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (30 PDB entries)

8. Domain d1rvf3_: 1rvf 3: [23518]
   Other proteins in same PDB: d1rvfh_, d1rvfl_
   protein/RNA complex

Details for d1rvf3_

PDB Entry: 1rvf, 4 Å

PDB Description: fab complexed with intact human rhinovirus

PDB Compounds: (3:) human rhinovirus 14 coat protein

SCOPe Domain Sequences for d1rvf3_:

Sequence; same for both SEQRES and ATOM records:

>d1rvf3_ b.121.4.1 (3:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

Timeline for d1rvf3_:

• d1rvf3_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvf3_ appears in SCOPe 2.02
  
• d1rvf3_ appears in SCOPe 2.04
  
• d1rvf3_ appears in the current release, SCOPe 2.08