Lineage for d1rvf3_ (1rvf 3:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1334633Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1334634Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1334752Protein Rhinovirus coat proteins [49670] (5 species)
  7. 1334805Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (30 PDB entries)
  8. 1334895Domain d1rvf3_: 1rvf 3: [23518]
    Other proteins in same PDB: d1rvfh_, d1rvfl_
    protein/RNA complex

Details for d1rvf3_

PDB Entry: 1rvf (more details), 4 Å

PDB Description: fab complexed with intact human rhinovirus
PDB Compounds: (3:) human rhinovirus 14 coat protein

SCOPe Domain Sequences for d1rvf3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvf3_ b.121.4.1 (3:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

SCOPe Domain Coordinates for d1rvf3_:

Click to download the PDB-style file with coordinates for d1rvf3_.
(The format of our PDB-style files is described here.)

Timeline for d1rvf3_: