Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Rhinovirus coat protein [49670] (5 species) |
Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries) |
Domain d1rvf3_: 1rvf 3: [23518] Other proteins in same PDB: d1rvfh_, d1rvfl_ |
PDB Entry: 1rvf (more details), 4 Å
SCOP Domain Sequences for d1rvf3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rvf3_ b.10.1.4 (3:) Rhinovirus coat protein {Human rhinovirus 14} glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
Timeline for d1rvf3_:
View in 3D Domains from other chains: (mouse over for more information) d1rvf1_, d1rvf2_, d1rvfh_, d1rvfl_ |