SCOP 1.57: Domain d1rvf2_: 1rvf 2:

Lineage for d1rvf2_ (1rvf 2:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (16 proteins)

6. Protein Rhinovirus coat protein [49670] (5 species)

7. Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries)

8. Domain d1rvf2_: 1rvf 2: [23517]
   Other proteins in same PDB: d1rvfh_, d1rvfl_

Details for d1rvf2_

PDB Entry: 1rvf, 4 Å

PDB Description: fab complexed with intact human rhinovirus

SCOP Domain Sequences for d1rvf2_:

Sequence; same for both SEQRES and ATOM records:

>d1rvf2_ b.10.1.4 (2:) Rhinovirus coat protein {Human rhinovirus 14}
gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
ctefsgirsksivpq

Timeline for d1rvf2_:

• d1rvf2_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvf2_ appears in SCOP 1.59
  
• d1rvf2_ last appears in SCOP 1.63