Lineage for d1rvf2_ (1rvf 2:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11706Protein Rhinovirus coat protein [49670] (5 species)
  7. 11707Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries)
  8. 11787Domain d1rvf2_: 1rvf 2: [23517]
    Other proteins in same PDB: d1rvfh_, d1rvfl_

Details for d1rvf2_

PDB Entry: 1rvf (more details), 4 Å

PDB Description: fab complexed with intact human rhinovirus

SCOP Domain Sequences for d1rvf2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvf2_ b.10.1.4 (2:) Rhinovirus coat protein {Human rhinovirus 14}
gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
ctefsgirsksivpq

SCOP Domain Coordinates for d1rvf2_:

Click to download the PDB-style file with coordinates for d1rvf2_.
(The format of our PDB-style files is described here.)

Timeline for d1rvf2_: