Lineage for d1rvf1_ (1rvf 1:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107303Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 107304Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 107416Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 107576Protein Rhinovirus coat protein [49670] (5 species)
  7. 107577Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries)
  8. 107656Domain d1rvf1_: 1rvf 1: [23516]
    Other proteins in same PDB: d1rvfh_, d1rvfl_

Details for d1rvf1_

PDB Entry: 1rvf (more details), 4 Å

PDB Description: fab complexed with intact human rhinovirus

SCOP Domain Sequences for d1rvf1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvf1_ b.10.1.4 (1:) Rhinovirus coat protein {Human rhinovirus 14}
tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
apralpytsigrtnypkntepvikkrkgdiksy

SCOP Domain Coordinates for d1rvf1_:

Click to download the PDB-style file with coordinates for d1rvf1_.
(The format of our PDB-style files is described here.)

Timeline for d1rvf1_: