Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (8 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [235108] (3 PDB entries) |
Domain d4k6ea_: 4k6e A: [235109] automated match to d2a6tb1 protein/RNA complex; complexed with mg |
PDB Entry: 4k6e (more details), 2.1 Å
SCOPe Domain Sequences for d4k6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k6ea_ d.113.1.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} sipvrgaaifnenlskillvqgtesdswsfprgkiskdendidccirevkeeigfdltdy iddnqfierniqgknykiflisgvsevfnfkpqvrneidkiewfdfkkisktmyksniky ylinsmmrplsmwlrhqrqikned
Timeline for d4k6ea_: