Lineage for d4k6ea_ (4k6e A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428504Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1428505Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1428789Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 1428790Protein automated matches [191036] (8 species)
    not a true protein
  7. 1428844Species Saccharomyces cerevisiae [TaxId:559292] [235108] (3 PDB entries)
  8. 1428847Domain d4k6ea_: 4k6e A: [235109]
    automated match to d2a6tb1
    protein/RNA complex; complexed with mg

Details for d4k6ea_

PDB Entry: 4k6e (more details), 2.1 Å

PDB Description: crystal structure of saccharomyces cerevisiae dcp2 nudix domain in complex with mg
PDB Compounds: (A:) mRNA-decapping enzyme subunit 2

SCOPe Domain Sequences for d4k6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k6ea_ d.113.1.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
sipvrgaaifnenlskillvqgtesdswsfprgkiskdendidccirevkeeigfdltdy
iddnqfierniqgknykiflisgvsevfnfkpqvrneidkiewfdfkkisktmyksniky
ylinsmmrplsmwlrhqrqikned

SCOPe Domain Coordinates for d4k6ea_:

Click to download the PDB-style file with coordinates for d4k6ea_.
(The format of our PDB-style files is described here.)

Timeline for d4k6ea_: