SCOPe 2.03: Domain d4k3xc_: 4k3x C:

Lineage for d4k3xc_ (4k3x C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (8 species)
   not a true protein

7. Species Influenza a virus [TaxId:11320] [228462] (6 PDB entries)

8. Domain d4k3xc_: 4k3x C: [235094]
   automated match to d4k3xe_
   complexed with nag, p4g

Details for d4k3xc_

PDB Entry: 4k3x, 2.15 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)

PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d4k3xc_:

Sequence; same for both SEQRES and ATOM records:

>d4k3xc_ b.19.1.0 (C:) automated matches {Influenza a virus [TaxId: 11320]}
dqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpaw
lmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidmt
rfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqts
naaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsiv
stgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaigd
cpkyvkaqelvlatglrnnpik

Timeline for d4k3xc_:

• d4k3xc_ is new in SCOPe 2.03-stable
  
• d4k3xc_ appears in SCOPe 2.04
  
• d4k3xc_ appears in the current release, SCOPe 2.08