SCOPe 2.08: Domain d4k3ga_: 4k3g A:

Lineage for d4k3ga_ (4k3g A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d4k3ga_: 4k3g A: [235082]
   automated match to d4k3hc_
   complexed with man

Details for d4k3ga_

PDB Entry: 4k3g, 1.93 Å

PDB Description: immunoglobulin lambda variable domain l5(l89s) fluorogen activating protein

PDB Compounds: (A:) Immunoglobulin lambda variable domain L5(L89S)

SCOPe Domain Sequences for d4k3ga_:

Sequence; same for both SEQRES and ATOM records:

>d4k3ga_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswtp
grfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvls

Timeline for d4k3ga_:

• d4k3ga_ first appeared in SCOPe 2.03
  
• d4k3ga_ appears in SCOPe 2.07