Lineage for d4jqia1 (4jqi A:6-175)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039281Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
  6. 2039282Protein Arrestin [49244] (3 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 2039315Species Norway rat (Rattus norvegicus) [TaxId:10116] [235033] (1 PDB entry)
  8. 2039316Domain d4jqia1: 4jqi A:6-175 [235034]
    Other proteins in same PDB: d4jqil1, d4jqil2
    automated match to d1g4ma1
    complexed with cl, edo, pro

Details for d4jqia1

PDB Entry: 4jqi (more details), 2.6 Å

PDB Description: Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
PDB Compounds: (A:) beta-arrestin-1

SCOPe Domain Sequences for d4jqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jqia1 b.1.18.11 (A:6-175) Arrestin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trvfkkaspngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerrvyvtltcafrygr
edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

SCOPe Domain Coordinates for d4jqia1:

Click to download the PDB-style file with coordinates for d4jqia1.
(The format of our PDB-style files is described here.)

Timeline for d4jqia1: