Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) |
Protein Arrestin [49244] (3 species) duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [235033] (1 PDB entry) |
Domain d4jqia1: 4jqi A:6-175 [235034] Other proteins in same PDB: d4jqil1, d4jqil2 automated match to d1g4ma1 complexed with cl, edo, pro |
PDB Entry: 4jqi (more details), 2.6 Å
SCOPe Domain Sequences for d4jqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jqia1 b.1.18.11 (A:6-175) Arrestin {Norway rat (Rattus norvegicus) [TaxId: 10116]} trvfkkaspngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerrvyvtltcafrygr edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
Timeline for d4jqia1: