SCOPe 2.05: Domain d4jpkl2: 4jpk L:110-214

Lineage for d4jpkl2 (4jpk L:110-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4jpkl2: 4jpk L:110-214 [235032]
   Other proteins in same PDB: d4jpkl1
   automated match to d1n0xl2
   complexed with nag

Details for d4jpkl2

PDB Entry: 4jpk, 2.4 Å

PDB Description: crystal structure of the germline-targeting hiv-1 gp120 engineered outer domain eod-gt6 in complex with a putative vrc01 germline precursor fab

PDB Compounds: (L:) Putative VRC01 germline precursor Fab light chain

SCOPe Domain Sequences for d4jpkl2:

Sequence; same for both SEQRES and ATOM records:

>d4jpkl2 b.1.1.2 (L:110-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rstvapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4jpkl2:

• d4jpkl2 first appeared in SCOPe 2.03
  
• d4jpkl2 appears in SCOPe 2.04
  
• d4jpkl2 appears in SCOPe 2.06
  
• d4jpkl2 appears in the current release, SCOPe 2.08