Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Escherichia coli [TaxId:562] [224854] (11 PDB entries) |
Domain d4jpkl2: 4jpk L:110-214 [235032] Other proteins in same PDB: d4jpkl1 automated match to d1n0xl2 complexed with nag |
PDB Entry: 4jpk (more details), 2.4 Å
SCOPe Domain Sequences for d4jpkl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jpkl2 b.1.1.2 (L:110-214) automated matches {Escherichia coli [TaxId: 562]} rstvapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4jpkl2: