Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [235027] (1 PDB entry) |
Domain d4jota1: 4jot A:1-253 [235028] Other proteins in same PDB: d4jota2 automated match to d2vrea_ complexed with gol |
PDB Entry: 4jot (more details), 1.94 Å
SCOPe Domain Sequences for d4jota1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]} mtyqsirltqrplsqdgttqggtvatltlaakmgsmgpafwqefpqalselgdarvlivr geqvfsagldvksngaaivpalgkpdafkavvdemhavteglaalpmpviaavhgwciga gleliagadlrlcsqdarfslpevklgitadlgglqrlphligrgrtahlaltgeaidaa taerwglvtevlpdqdalfaraealaehlaalpakalegtkralsdglphaeslaaavrw naehmtvealqag
Timeline for d4jota1: