SCOPe 2.08: Domain d4jota1: 4jot A:1-253

Lineage for d4jota1 (4jot A:1-253)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [235027] (1 PDB entry)

8. Domain d4jota1: 4jot A:1-253 [235028]
   Other proteins in same PDB: d4jota2
   automated match to d2vrea_
   complexed with gol

Details for d4jota1

PDB Entry: 4jot, 1.94 Å

PDB Description: Crystal structure of enoyl-CoA hydrotase from Deinococcus radiodurans R1

PDB Compounds: (A:) Enoyl-CoA hydratase, putative

SCOPe Domain Sequences for d4jota1:

Sequence; same for both SEQRES and ATOM records:

>d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}
mtyqsirltqrplsqdgttqggtvatltlaakmgsmgpafwqefpqalselgdarvlivr
geqvfsagldvksngaaivpalgkpdafkavvdemhavteglaalpmpviaavhgwciga
gleliagadlrlcsqdarfslpevklgitadlgglqrlphligrgrtahlaltgeaidaa
taerwglvtevlpdqdalfaraealaehlaalpakalegtkralsdglphaeslaaavrw
naehmtvealqag

Timeline for d4jota1:

• d4jota1 first appeared in SCOPe 2.03, called d4jota_
  
• d4jota1 appears in SCOPe 2.07