Lineage for d4jjga1 (4jjg A:1-244)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350706Species Methanothermobacter marburgensis [TaxId:79929] [235006] (2 PDB entries)
  8. 1350709Domain d4jjga1: 4jjg A:1-244 [235012]
    Other proteins in same PDB: d4jjga2, d4jjgb2
    automated match to d2b0ja2
    complexed with fe9, ic9

Details for d4jjga1

PDB Entry: 4jjg (more details), 2.5 Å

PDB Description: Crystal structure of FE-hydrogenase from methanothermobacter marburgensis in complex with toluenesulfonylmethylisocyanide
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d4jjga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jjga1 c.2.1.0 (A:1-244) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
mklailgagcyrthaasgitnfsracevaemvgkpeiamthstitmgaelkelagvdevv
vadpvfdnqftviddfayedvieahkedpekimpqirekvnevakelpkppegaihfthp
edlgfeittddreavadadfimtwfpkgdmqpdiinkfiddikpgaivthactipttkfy
kifeqkhgdlvtkpetlnvtsyhpgavpemkgqvyiaegyasedaietlfelgqkargna
yrlp

SCOPe Domain Coordinates for d4jjga1:

Click to download the PDB-style file with coordinates for d4jjga1.
(The format of our PDB-style files is described here.)

Timeline for d4jjga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jjga2