SCOPe 2.06: Domain d4jjfb2: 4jjf B:245-344

Lineage for d4jjfb2 (4jjf B:245-344)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (35 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:79929] [235008] (2 PDB entries)

8. Domain d4jjfb2: 4jjf B:245-344 [235011]
   Other proteins in same PDB: d4jjfa1, d4jjfb1
   automated match to d2b0ja1
   complexed with fe9, n2i

Details for d4jjfb2

PDB Entry: 4jjf, 2.2 Å

PDB Description: Crystal structure of FE-hydrogenase from methanothermobacter marburgensis in complex with 2-naphthylisocyanide

PDB Compounds: (B:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d4jjfb2:

Sequence; same for both SEQRES and ATOM records:

>d4jjfb2 a.100.1.0 (B:245-344) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
aellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalmekvgi
dkmeenldpgallgtadsmnfgasaeilptvfeilekrkk

Timeline for d4jjfb2:

• d4jjfb2 first appeared in SCOPe 2.03
  
• d4jjfb2 appears in SCOPe 2.05
  
• d4jjfb2 appears in SCOPe 2.07
  
• d4jjfb2 appears in the current release, SCOPe 2.08