SCOPe 2.08: Domain d4jgfb_: 4jgf B:

Lineage for d4jgfb_ (4jgf B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)

8. Domain d4jgfb_: 4jgf B: [234987]
   automated match to d1bd7a_
   mutant

Details for d4jgfb_

PDB Entry: 4jgf, 2.5 Å

PDB Description: Crystal Structure of the Cataract-Causing P23T gamma D-Crystallin Mutant

PDB Compounds: (B:) Gamma-crystallin D

SCOPe Domain Sequences for d4jgfb_:

Sequence; same for both SEQRES and ATOM records:

>d4jgfb_ b.11.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhtnlqpylsrcnsarvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvi

Timeline for d4jgfb_:

• d4jgfb_ first appeared in SCOPe 2.03
  
• d4jgfb_ appears in SCOPe 2.07