Lineage for d4jg3a1 (4jg3 A:4-262)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224511Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2224512Protein automated matches [190734] (12 species)
    not a true protein
  7. 2224549Species Pseudomonas aeruginosa [TaxId:287] [226583] (2 PDB entries)
  8. 2224550Domain d4jg3a1: 4jg3 A:4-262 [234986]
    Other proteins in same PDB: d4jg3a2
    automated match to d2jc5a_
    complexed with cl

Details for d4jg3a1

PDB Entry: 4jg3 (more details), 1.8 Å

PDB Description: Crystal structure of catabolite repression control protein (crc) from Pseudomonas aeruginosa
PDB Compounds: (A:) Catabolite repression control protein

SCOPe Domain Sequences for d4jg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jg3a1 d.151.1.0 (A:4-262) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflyacda
elpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgdesln
qkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperawlde
vfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnaklprq
prfsqhaplivdydwqlsi

SCOPe Domain Coordinates for d4jg3a1:

Click to download the PDB-style file with coordinates for d4jg3a1.
(The format of our PDB-style files is described here.)

Timeline for d4jg3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jg3a2