Lineage for d4jg3a_ (4jg3 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676253Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1676254Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1676362Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 1676363Protein automated matches [190734] (8 species)
    not a true protein
  7. 1676396Species Pseudomonas aeruginosa [TaxId:287] [226583] (2 PDB entries)
  8. 1676397Domain d4jg3a_: 4jg3 A: [234986]
    automated match to d2jc5a_
    complexed with cl

Details for d4jg3a_

PDB Entry: 4jg3 (more details), 1.8 Å

PDB Description: Crystal structure of catabolite repression control protein (crc) from Pseudomonas aeruginosa
PDB Compounds: (A:) Catabolite repression control protein

SCOPe Domain Sequences for d4jg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jg3a_ d.151.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gpamriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflya
cdaelpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgde
slnqkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperaw
ldevfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnakl
prqprfsqhaplivdydwqlsi

SCOPe Domain Coordinates for d4jg3a_:

Click to download the PDB-style file with coordinates for d4jg3a_.
(The format of our PDB-style files is described here.)

Timeline for d4jg3a_: