Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (17 species) not a true protein |
Species Branchiostoma lanceolatum [TaxId:7740] [227942] (4 PDB entries) |
Domain d4jf9b_: 4jf9 B: [234984] automated match to d4jeoa_ |
PDB Entry: 4jf9 (more details), 2.33 Å
SCOPe Domain Sequences for d4jf9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jf9b_ d.22.1.0 (B:) automated matches {Branchiostoma lanceolatum [TaxId: 7740]} splpathdlhisgsinghefdlegsgkgnakegyqelhlksnkgdlsfspwilvpnigyg fyqylpfpdgamspyqaamhdgsgyvmhrsmqfedgamlhsdhryiykgnhikgefrltg sgfpadgpvmtnsltaadwcvdkllypndntiigkfdwtytttsgkryqsdvqtnvtfgk piaadilkkqpmfvfrkvelkhtktelnfkqwqkafqdia
Timeline for d4jf9b_: