Lineage for d4j9yb1 (4j9y B:396-487)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577229Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 2577230Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 2577231Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)
  6. 2577232Protein Small-conductance potassium channel [64528] (2 species)
  7. 2577233Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)
  8. 2577234Domain d4j9yb1: 4j9y B:396-487 [234943]
    Other proteins in same PDB: d4j9yb2, d4j9yb3, d4j9yr_
    automated match to d4j9zb_
    complexed with ca, gol, so4

Details for d4j9yb1

PDB Entry: 4j9y (more details), 1.51 Å

PDB Description: Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant
PDB Compounds: (B:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d4j9yb1:

Sequence, based on SEQRES records: (download)

>d4j9yb1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrk
flqaihqlrsvkmeqrklndqantlvdlaktq

Sequence, based on observed residues (ATOM records): (download)

>d4j9yb1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rkleltkaedtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihql
rsvkmeqrklndqantlvdlaktq

SCOPe Domain Coordinates for d4j9yb1:

Click to download the PDB-style file with coordinates for d4j9yb1.
(The format of our PDB-style files is described here.)

Timeline for d4j9yb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4j9yr_