Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (18 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [225503] (6 PDB entries) |
Domain d4j7ba_: 4j7b A: [234936] Other proteins in same PDB: d4j7bb1, d4j7bb2, d4j7be1, d4j7be2 automated match to d2rkua_ |
PDB Entry: 4j7b (more details), 2.3 Å
SCOPe Domain Sequences for d4j7ba_:
Sequence, based on SEQRES records: (download)
>d4j7ba_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} pksaplkeipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllk phqkekmsteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtep earyfmrqtiqgvqylhnnrvihrnlklgnlflnddmdvkigdfglatkiefdgfrkktl cgtpnyiapevlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvp rhinpvasalirrmlhadptlrpsvaelltdefftsgyapmrlptscltvpprf
>d4j7ba_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} pksaplkeipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllk phqkekmsteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtep earyfmrqtiqgvqylhnnrvihrnlklgnlflnddmdvkigdfglatkicgtpnyiape vlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinpvasal irrmlhadptlrpsvaelltdefftsgyapmrlptscltvpprf
Timeline for d4j7ba_:
View in 3D Domains from other chains: (mouse over for more information) d4j7bb1, d4j7bb2, d4j7be1, d4j7be2 |