Lineage for d4j5ub_ (4j5u B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381305Species Rickettsia rickettsii [TaxId:392021] [234926] (1 PDB entry)
  8. 1381307Domain d4j5ub_: 4j5u B: [234927]
    automated match to d3n0lb_

Details for d4j5ub_

PDB Entry: 4j5u (more details), 1.7 Å

PDB Description: X-ray crystal structure of a serine hydroxymethyltransferase with covalently bound PLP from Rickettsia rickettsii str. Sheila Smith
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4j5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j5ub_ c.67.1.0 (B:) automated matches {Rickettsia rickettsii [TaxId: 392021]}
mnifnnnlhetdkeineiikheklrqssvieliasenfvspavleaqgalltnkyaegyp
skrfyngceevdkaenlaiervkklfnckyanvqphsgsqanqavylallqpgdtvlgms
ldsgghlthgaapnmsgkwfnavsysvnketylidydeierladlhkpklliagfsaypr
nidfakfreivdkvgayfmadiahiaglvatgehqspipyahavtstthktlrgprggli
lsndeeighkinsalfpglqggplmhiiaakavaflenlqpeyksyiqqvisnakalass
lqergydiltggtdnhivlvdlrkdgitgklaansldragitcnknaipfdetspfitsg
irlgtpacttrgfkekdfvlvghmvadildglknnednsaleqqvlnevtklielfpfyg

SCOPe Domain Coordinates for d4j5ub_:

Click to download the PDB-style file with coordinates for d4j5ub_.
(The format of our PDB-style files is described here.)

Timeline for d4j5ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4j5ua_