Lineage for d4is3a_ (4is3 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107414Species Clostridium scindens [TaxId:29347] [234900] (2 PDB entries)
  8. 2107416Domain d4is3a_: 4is3 A: [234901]
    Other proteins in same PDB: d4is3c2
    automated match to d3iaha_
    complexed with act, nad, unl

Details for d4is3a_

PDB Entry: 4is3 (more details), 2 Å

PDB Description: crystal structure of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 in complex with a putative nad(+)-oh- adduct at 2.0 a resolution
PDB Compounds: (A:) Bile acid 3-alpha hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d4is3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4is3a_ c.2.1.0 (A:) automated matches {Clostridium scindens [TaxId: 29347]}
mnlvqdkvtiitggtrgigfaaakifidngakvsifgetqeevdtalaqlkelypeeevl
gfapdltsrdavmaavgqvaqkygrldvminnagitsnnvfsrvseeefkhimdinvtgv
fngawcayqcmkdakkgviintasvtgifgslsgvgypaskasviglthglgreiirkni
rvvgvapgvvntdmtngnppeimegylkalpmkrmlepeeianvylflasdlasgitatt
vsvdgayrp

SCOPe Domain Coordinates for d4is3a_:

Click to download the PDB-style file with coordinates for d4is3a_.
(The format of our PDB-style files is described here.)

Timeline for d4is3a_: