Lineage for d4ioih_ (4ioi H:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481774Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1481775Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1481776Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1481797Protein automated matches [191290] (4 species)
    not a true protein
  7. 1481819Species Staphylococcus aureus [TaxId:158878] [228180] (3 PDB entries)
  8. 1481821Domain d4ioih_: 4ioi H: [234889]
    Other proteins in same PDB: d4ioia1, d4ioia2, d4ioie_
    automated match to d4hjgh_

Details for d4ioih_

PDB Entry: 4ioi (more details), 1.95 Å

PDB Description: meditope-enabled trastuzumab in complex with cqfdlstrrlkc
PDB Compounds: (H:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4ioih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ioih_ a.8.1.1 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
synkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

SCOPe Domain Coordinates for d4ioih_:

Click to download the PDB-style file with coordinates for d4ioih_.
(The format of our PDB-style files is described here.)

Timeline for d4ioih_: