Lineage for d4ioie_ (4ioi E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403793Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1403794Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1403879Protein automated matches [190067] (3 species)
    not a true protein
  7. 1403880Species Finegoldia magna [TaxId:1260] [188811] (5 PDB entries)
  8. 1403884Domain d4ioie_: 4ioi E: [234888]
    Other proteins in same PDB: d4ioia1, d4ioia2, d4ioih_
    automated match to d4hjge_

Details for d4ioie_

PDB Entry: 4ioi (more details), 1.95 Å

PDB Description: meditope-enabled trastuzumab in complex with cqfdlstrrlkc
PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d4ioie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ioie_ d.15.7.1 (E:) automated matches {Finegoldia magna [TaxId: 1260]}
sevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnik
fag

SCOPe Domain Coordinates for d4ioie_:

Click to download the PDB-style file with coordinates for d4ioie_.
(The format of our PDB-style files is described here.)

Timeline for d4ioie_: