SCOPe 2.03: Domain d4ijzb2: 4ijz B:131-275

Lineage for d4ijzb2 (4ijz B:131-275)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (2 species)

7. Species Escherichia coli [TaxId:83333] [234868] (2 PDB entries)

8. Domain d4ijzb2: 4ijz B:131-275 [234871]
   automated match to d1gqza2
   complexed with no3

Details for d4ijzb2

PDB Entry: 4ijz, 2 Å

PDB Description: Crystal structure of diaminopimelate epimerase from Escherichia coli

PDB Compounds: (B:) Diaminopimelate epimerase

SCOPe Domain Sequences for d4ijzb2:

Sequence; same for both SEQRES and ATOM records:

>d4ijzb2 d.21.1.1 (B:131-275) Diaminopimelate epimerase {Escherichia coli [TaxId: 83333]}
rankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvlesherfperan
igfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrvelpggrldia
wkgpghplymtgpavhvydgfihlh

Timeline for d4ijzb2:

• d4ijzb2 is new in SCOPe 2.03-stable
  
• d4ijzb2 appears in SCOPe 2.04
  
• d4ijzb2 appears in the current release, SCOPe 2.08