SCOPe 2.08: Domain d4icnb_: 4icn B:

Lineage for d4icnb_ (4icn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Shewanella benthica [TaxId:43661] [229590] (1 PDB entry)

8. Domain d4icnb_: 4icn B: [234842]
   automated match to d4icna_
   complexed with cl, gol, so4, trs

Details for d4icnb_

PDB Entry: 4icn, 2.5 Å

PDB Description: Dihydrodipicolinate synthase from shewanella benthica

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4icnb_:

Sequence; same for both SEQRES and ATOM records:

>d4icnb_ c.1.10.0 (B:) automated matches {Shewanella benthica [TaxId: 43661]}
hmingsivalitplnsdgtvdytsleklveyhitegtdaivavgttgesatlpisehiav
vgqtvkfasgripviggnganataeaieltkaqnklgvaamlgvtpyynkpspkgliahy
tavaastdipqilynvpgrtavdmlpetiaqlvevpniigvkdatgdvarvkqlrdlcgn
dfllysgddatarefltlggdgvisvannivpklfklmcdaalagdtqaamaaedqikgl
fsalfceanpipvkwaahkmglisqgdirlpltelstefhgllldamknarievk

Timeline for d4icnb_:

• d4icnb_ first appeared in SCOPe 2.03
  
• d4icnb_ appears in SCOPe 2.07