SCOPe 2.06: Domain d4i6uc_: 4i6u C:

Lineage for d4i6uc_ (4i6u C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (10 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4i6uc_: 4i6u C: [234823]
   automated match to d4i6ue_
   complexed with act, gol, na, peg; mutant

Details for d4i6uc_

PDB Entry: 4i6u, 1.97 Å

PDB Description: Crystal Structure of a Y37F mutant of the Restriction-Modification Controller Protein C.Esp1396I

PDB Compounds: (C:) Regulatory protein

SCOPe Domain Sequences for d4i6uc_:

Sequence; same for both SEQRES and ATOM records:

>d4i6uc_ a.35.1.0 (C:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtfisgiernsrnltikslelimkglev
sdvvffemlikeilk

Timeline for d4i6uc_:

• d4i6uc_ first appeared in SCOPe 2.03
  
• d4i6uc_ appears in SCOPe 2.05
  
• d4i6uc_ appears in SCOPe 2.07
  
• d4i6uc_ appears in the current release, SCOPe 2.08