Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
Domain d4i5bb2: 4i5b B:93-193 [234813] Other proteins in same PDB: d4i5ba1, d4i5ba2, d4i5bb1, d4i5bd1, d4i5bd2, d4i5be1 automated match to d4i5be2 |
PDB Entry: 4i5b (more details), 2.12 Å
SCOPe Domain Sequences for d4i5bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5bb2 b.1.1.2 (B:93-193) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewrarse
Timeline for d4i5bb2: