SCOPe 2.07: Domain d4i5bb2: 4i5b B:93-193

Lineage for d4i5bb2 (4i5b B:93-193)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d4i5bb2: 4i5b B:93-193 [234813]
   Other proteins in same PDB: d4i5ba1, d4i5ba2, d4i5bb1, d4i5bd1, d4i5bd2, d4i5be1
   automated match to d4i5be2

Details for d4i5bb2

PDB Entry: 4i5b, 2.12 Å

PDB Description: structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4i5bb2:

Sequence; same for both SEQRES and ATOM records:

>d4i5bb2 b.1.1.2 (B:93-193) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrarse

Timeline for d4i5bb2:

• d4i5bb2 first appeared in SCOPe 2.03
  
• d4i5bb2 appears in SCOPe 2.06
  
• d4i5bb2 appears in the current release, SCOPe 2.08