Lineage for d4i3xd_ (4i3x D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387939Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1387940Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1388324Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1388325Protein automated matches [190683] (29 species)
    not a true protein
  7. 1388494Species Sinorhizobium meliloti [TaxId:266834] [226320] (7 PDB entries)
  8. 1388502Domain d4i3xd_: 4i3x D: [234803]
    automated match to d4i3ve_
    complexed with nad, pae

Details for d4i3xd_

PDB Entry: 4i3x (more details), 2.07 Å

PDB Description: structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetate and cofactor nad+
PDB Compounds: (D:) Aldehyde dehydrogenase (NAD+)

SCOPe Domain Sequences for d4i3xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i3xd_ c.82.1.0 (D:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
vrhepmriagrlvdtddrvevrypwndtvvgtvpagraehareafaiaaayqpkltryer
qkillataealaarkeeisdvitlelgiskadslyevgrafdvftlagqmcirddgeifs
cdltphgkarkiftmrepltaisaitpfnhplnmvahkvapaiatnncvvvkpteltpmt
allladilyeaglppemlsvvtgwpadigmemitnphvdlvtftgsvpvgkliaanahyk
rqvlelggndpliilndlsdddlaraadlavagatknsgqrctavkrilcqesvadrfvp
lvlerakrlrfgdpmdrstdlgtvihekaaalfeervmraaeegadilyhpgrsgallpp
ivvdrvphqsdlvleetfgpiipivrvpddddatitlsnstafglssgvctndyrrmqky
iaglkvgtvniwevpgyriemspfggikdsgngykegvieamksftnvktfslpwp

SCOPe Domain Coordinates for d4i3xd_:

Click to download the PDB-style file with coordinates for d4i3xd_.
(The format of our PDB-style files is described here.)

Timeline for d4i3xd_: