Lineage for d4i15a_ (4i15 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1286061Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1286062Protein automated matches [190983] (4 species)
    not a true protein
  7. 1286128Species Trypanosoma brucei [TaxId:5691] [234760] (1 PDB entry)
  8. 1286129Domain d4i15a_: 4i15 A: [234762]
    automated match to d3g58a_
    complexed with mg, zn

Details for d4i15a_

PDB Entry: 4i15 (more details), 1.65 Å

PDB Description: Crystal structure of TbrPDEB1
PDB Compounds: (A:) Class 1 phosphodiesterase PDEB1

SCOPe Domain Sequences for d4i15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i15a_ a.211.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervletr

SCOPe Domain Coordinates for d4i15a_:

Click to download the PDB-style file with coordinates for d4i15a_.
(The format of our PDB-style files is described here.)

Timeline for d4i15a_: