Lineage for d4hzfa2 (4hzf A:139-208)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984294Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)
  8. 1984299Domain d4hzfa2: 4hzf A:139-208 [234740]
    Other proteins in same PDB: d4hzfa1, d4hzfb1
    automated match to d4hzfb2
    complexed with cmp, gol, po4

Details for d4hzfa2

PDB Entry: 4hzf (more details), 1.48 Å

PDB Description: structure of the wild type Catabolite gene Activator Protein
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d4hzfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hzfa2 a.4.5.0 (A:139-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d4hzfa2:

Click to download the PDB-style file with coordinates for d4hzfa2.
(The format of our PDB-style files is described here.)

Timeline for d4hzfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hzfa1