Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (8 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries) |
Domain d4hzfa1: 4hzf A:9-138 [234739] Other proteins in same PDB: d4hzfa2, d4hzfb2 automated match to d4hzfb1 complexed with cmp, gol, po4 |
PDB Entry: 4hzf (more details), 1.48 Å
SCOPe Domain Sequences for d4hzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hzfa1 b.82.3.2 (A:9-138) automated matches {Escherichia coli K-12 [TaxId: 83333]} dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt sekvgnlafl
Timeline for d4hzfa1: