Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (13 species) not a true protein |
Species Acidaminococcus sp. [TaxId:563191] [234735] (1 PDB entry) |
Domain d4hyrb2: 4hyr B:134-442 [234738] Other proteins in same PDB: d4hyra1, d4hyra3, d4hyrb1, d4hyrb3 automated match to d4g8ta2 complexed with cl, edo, gol |
PDB Entry: 4hyr (more details), 1.84 Å
SCOPe Domain Sequences for d4hyrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hyrb2 c.1.11.2 (B:134-442) automated matches {Acidaminococcus sp. [TaxId: 563191]} agqqrdfvrflgylffvgdrkktdlpyqseedsdcewyrlrneeaidaehvvalckaakn kygfkdfklkggvlrgdeemkvikamkkafpdarmdldpngawhlddavryvadmhgilt ycedpcgaedgysgreimsefrrrtgfptatnmiatdwrqvghslesqavdiiladphfw tmngsvrvaqmchefgytwgshsnnhfdislamcvhvgaavpgeynaldthwiwqegrer ltkeplkianggikvpdkpglgveidrdqvmkahelykkhclgarndaitmqylipgwkf dakspclvr
Timeline for d4hyrb2: