SCOPe 2.08: Domain d4hyrb2: 4hyr B:134-442

Lineage for d4hyrb2 (4hyr B:134-442)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Acidaminococcus sp. [TaxId:563191] [234735] (1 PDB entry)

8. Domain d4hyrb2: 4hyr B:134-442 [234738]
   Other proteins in same PDB: d4hyra1, d4hyra3, d4hyrb1, d4hyrb3
   automated match to d4g8ta2
   complexed with cl, edo, gol

Details for d4hyrb2

PDB Entry: 4hyr, 1.84 Å

PDB Description: structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder

PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4hyrb2:

Sequence; same for both SEQRES and ATOM records:

>d4hyrb2 c.1.11.2 (B:134-442) automated matches {Acidaminococcus sp. [TaxId: 563191]}
agqqrdfvrflgylffvgdrkktdlpyqseedsdcewyrlrneeaidaehvvalckaakn
kygfkdfklkggvlrgdeemkvikamkkafpdarmdldpngawhlddavryvadmhgilt
ycedpcgaedgysgreimsefrrrtgfptatnmiatdwrqvghslesqavdiiladphfw
tmngsvrvaqmchefgytwgshsnnhfdislamcvhvgaavpgeynaldthwiwqegrer
ltkeplkianggikvpdkpglgveidrdqvmkahelykkhclgarndaitmqylipgwkf
dakspclvr

Timeline for d4hyrb2:

• d4hyrb2 first appeared in SCOPe 2.03
  
• d4hyrb2 appears in SCOPe 2.07