SCOPe 2.03: Domain d4hwsb1: 4hws B:242-532

Lineage for d4hwsb1 (4hws B:242-532)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein automated matches [193659] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [227935] (4 PDB entries)

8. Domain d4hwsb1: 4hws B:242-532 [234720]
   Other proteins in same PDB: d4hwsa2, d4hwsb2
   automated match to d4hwpb1
   protein/RNA complex; complexed with 1b3, zn

Details for d4hwsb1

PDB Entry: 4hws, 1.7 Å

PDB Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor

PDB Compounds: (B:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4hwsb1:

Sequence; same for both SEQRES and ATOM records:

>d4hwsb1 d.104.1.1 (B:242-532) automated matches {Escherichia coli [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

Timeline for d4hwsb1:

• d4hwsb1 is new in SCOPe 2.03-stable
  
• d4hwsb1 appears in SCOPe 2.04
  
• d4hwsb1 appears in the current release, SCOPe 2.08