Lineage for d4hw0c_ (4hw0 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260327Species Sulfolobus solfataricus [TaxId:273057] [228633] (1 PDB entry)
  8. 1260330Domain d4hw0c_: 4hw0 C: [234707]
    automated match to d4hw0a_

Details for d4hw0c_

PDB Entry: 4hw0 (more details), 2 Å

PDB Description: crystal structure of sso10a-2, a dna-binding protein from sulfolobus solfataricus
PDB Compounds: (C:) DNA-binding protein Sso10a-2

SCOPe Domain Sequences for d4hw0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hw0c_ a.4.5.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
rgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalniktendrkiyei
tekgkllrthieefikirenlysakekvsellr

SCOPe Domain Coordinates for d4hw0c_:

Click to download the PDB-style file with coordinates for d4hw0c_.
(The format of our PDB-style files is described here.)

Timeline for d4hw0c_: