SCOPe 2.03: Domain d4hvfc_: 4hvf C:

Lineage for d4hvfc_ (4hvf C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (17 species)
   not a true protein

7. Species Branchiostoma lanceolatum [TaxId:7740] [227942] (4 PDB entries)

8. Domain d4hvfc_: 4hvf C: [234706]
   automated match to d4hvfd_
   complexed with gol

Details for d4hvfc_

PDB Entry: 4hvf, 1.7 Å

PDB Description: crystal structure of green fluorescent protein langfp(branchiostoma lanceolatum)

PDB Compounds: (C:) Green fluorescent protein blFP-Y6

SCOPe Domain Sequences for d4hvfc_:

Sequence; same for both SEQRES and ATOM records:

>d4hvfc_ d.22.1.0 (C:) automated matches {Branchiostoma lanceolatum [TaxId: 7740]}
sllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigyg
fyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvig
tgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfak
piaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm

Timeline for d4hvfc_:

• d4hvfc_ is new in SCOPe 2.03-stable
  
• d4hvfc_ appears in SCOPe 2.04
  
• d4hvfc_ appears in the current release, SCOPe 2.08, called d4hvfc1