SCOPe 2.05: Domain d4hnca1: 4hnc A:3-132

Lineage for d4hnca1 (4hnc A:3-132)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [228629] (6 PDB entries)

8. Domain d4hnca1: 4hnc A:3-132 [234664]
   Other proteins in same PDB: d4hnca2, d4hncb2
   automated match to d4hncb1
   complexed with 0ut, mg

Details for d4hnca1

PDB Entry: 4hnc, 1.89 Å

PDB Description: p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid

PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d4hnca1:

Sequence; same for both SEQRES and ATOM records:

>d4hnca1 d.54.1.0 (A:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfslagytglirmaaagidmaawdalgkvhetp
lvkllganar

Timeline for d4hnca1:

• d4hnca1 first appeared in SCOPe 2.03
  
• d4hnca1 appears in SCOPe 2.04
  
• d4hnca1 appears in SCOPe 2.06
  
• d4hnca1 appears in the current release, SCOPe 2.08