Lineage for d4hk1a2 (4hk1 A:127-254)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431831Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1431832Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1432176Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1432177Protein automated matches [226907] (7 species)
    not a true protein
  7. 1432178Species Drosophila melanogaster [TaxId:7227] [234655] (1 PDB entry)
  8. 1432180Domain d4hk1a2: 4hk1 A:127-254 [234657]
    automated match to d1plqa2

Details for d4hk1a2

PDB Entry: 4hk1 (more details), 2 Å

PDB Description: Crystal Structure of PCNA from Drosophila melanogaster
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4hk1a2:

Sequence, based on SEQRES records: (download)

>d4hk1a2 d.131.1.0 (A:127-254) automated matches {Drosophila melanogaster [TaxId: 7227]}
gipetdfscvvrmpamefaricrdlaqfsesvvicctkegvkfsasgdvgtaniklaqtg
svdkeeeaviiemqepvtltfacrylnaftkatplstqvqlsmcadvplvveyaikdlgh
iryylapk

Sequence, based on observed residues (ATOM records): (download)

>d4hk1a2 d.131.1.0 (A:127-254) automated matches {Drosophila melanogaster [TaxId: 7227]}
gipsvvrmpamefaricrdlaqfsesvvicctkgvkfsasgdvgtaniklaqteeeavii
emqepvtltfacrylnaftkatplstqvqlsmcadvplvveyaikdlghiryylapk

SCOPe Domain Coordinates for d4hk1a2:

Click to download the PDB-style file with coordinates for d4hk1a2.
(The format of our PDB-style files is described here.)

Timeline for d4hk1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hk1a1