Lineage for d4hk1a2 (4hk1 A:127-254)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977361Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [234655] (1 PDB entry)
  8. 2977363Domain d4hk1a2: 4hk1 A:127-254 [234657]
    Other proteins in same PDB: d4hk1a3
    automated match to d1plqa2

Details for d4hk1a2

PDB Entry: 4hk1 (more details), 2 Å

PDB Description: Crystal Structure of PCNA from Drosophila melanogaster
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4hk1a2:

Sequence, based on SEQRES records: (download)

>d4hk1a2 d.131.1.0 (A:127-254) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gipetdfscvvrmpamefaricrdlaqfsesvvicctkegvkfsasgdvgtaniklaqtg
svdkeeeaviiemqepvtltfacrylnaftkatplstqvqlsmcadvplvveyaikdlgh
iryylapk

Sequence, based on observed residues (ATOM records): (download)

>d4hk1a2 d.131.1.0 (A:127-254) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gipsvvrmpamefaricrdlaqfsesvvicctkgvkfsasgdvgtaniklaqteeeavii
emqepvtltfacrylnaftkatplstqvqlsmcadvplvveyaikdlghiryylapk

SCOPe Domain Coordinates for d4hk1a2:

Click to download the PDB-style file with coordinates for d4hk1a2.
(The format of our PDB-style files is described here.)

Timeline for d4hk1a2: