Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [234655] (1 PDB entry) |
Domain d4hk1a2: 4hk1 A:127-254 [234657] Other proteins in same PDB: d4hk1a3 automated match to d1plqa2 |
PDB Entry: 4hk1 (more details), 2 Å
SCOPe Domain Sequences for d4hk1a2:
Sequence, based on SEQRES records: (download)
>d4hk1a2 d.131.1.0 (A:127-254) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gipetdfscvvrmpamefaricrdlaqfsesvvicctkegvkfsasgdvgtaniklaqtg svdkeeeaviiemqepvtltfacrylnaftkatplstqvqlsmcadvplvveyaikdlgh iryylapk
>d4hk1a2 d.131.1.0 (A:127-254) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gipsvvrmpamefaricrdlaqfsesvvicctkgvkfsasgdvgtaniklaqteeeavii emqepvtltfacrylnaftkatplstqvqlsmcadvplvveyaikdlghiryylapk
Timeline for d4hk1a2: