SCOPe 2.03: Domain d4hafa2: 4haf A:342-444

Lineage for d4hafa2 (4haf A:342-444)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)

8. Domain d4hafa2: 4haf A:342-444 [234637]
   automated match to d1igtb4

Details for d4hafa2

PDB Entry: 4haf, 2.04 Å

PDB Description: crystal structure of fc-fragment of human igg2 antibody (primitive crystal form)

PDB Compounds: (A:) Ig gamma-2 chain C region

SCOPe Domain Sequences for d4hafa2:

Sequence; same for both SEQRES and ATOM records:

>d4hafa2 b.1.1.0 (A:342-444) automated matches {Homo sapiens [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppmldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d4hafa2:

• d4hafa2 is new in SCOPe 2.03-stable
  
• d4hafa2 appears in SCOPe 2.04
  
• d4hafa2 appears in the current release, SCOPe 2.08