Lineage for d4h73h_ (4h73 H:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876412Species Pyrobaculum sp. [TaxId:1104324] [228031] (3 PDB entries)
  8. 1876436Domain d4h73h_: 4h73 H: [234624]
    automated match to d4h73d_
    complexed with ndp, ni

Details for d4h73h_

PDB Entry: 4h73 (more details), 2.4 Å

PDB Description: thermostable aldehyde dehydrogenase from pyrobaculum sp. complexed with nadp+
PDB Compounds: (H:) aldehyde dehydrogenase

SCOPe Domain Sequences for d4h73h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h73h_ c.82.1.0 (H:) automated matches {Pyrobaculum sp. [TaxId: 1104324]}
vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
alk

SCOPe Domain Coordinates for d4h73h_:

Click to download the PDB-style file with coordinates for d4h73h_.
(The format of our PDB-style files is described here.)

Timeline for d4h73h_: