SCOPe 2.05: Domain d4h26b2: 4h26 B:93-190

Lineage for d4h26b2 (4h26 B:93-190)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4h26b2: 4h26 B:93-190 [234615]
   Other proteins in same PDB: d4h26a1, d4h26a2, d4h26b1, d4h26d1, d4h26d2, d4h26e1
   automated match to d4h26e2

Details for d4h26b2

PDB Entry: 4h26, 2.5 Å

PDB Description: TCR interaction with peptide mimics of nickel offers structure insight to nickel contact allergy

PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d4h26b2:

Sequence; same for both SEQRES and ATOM records:

>d4h26b2 b.1.1.2 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypaktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d4h26b2:

• d4h26b2 first appeared in SCOPe 2.03
  
• d4h26b2 appears in SCOPe 2.04
  
• d4h26b2 appears in SCOPe 2.06
  
• d4h26b2 appears in the current release, SCOPe 2.07