SCOPe 2.04: Domain d4h26b1: 4h26 B:3-92

Lineage for d4h26b1 (4h26 B:3-92)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)

8. Domain d4h26b1: 4h26 B:3-92 [234614]
   Other proteins in same PDB: d4h26a1, d4h26a2, d4h26b2, d4h26d1, d4h26d2, d4h26e2
   automated match to d4h26e1

Details for d4h26b1

PDB Entry: 4h26, 2.5 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy

PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d4h26b1:

Sequence; same for both SEQRES and ATOM records:

>d4h26b1 d.19.1.1 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
sqkdlleqkrgqvdtycrhnygvvesftvq

Timeline for d4h26b1:

• d4h26b1 first appeared in SCOPe 2.03
  
• d4h26b1 appears in SCOPe 2.05
  
• d4h26b1 appears in the current release, SCOPe 2.08