SCOPe 2.06: Domain d4h25e1: 4h25 E:6-92

Lineage for d4h25e1 (4h25 E:6-92)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries)

8. Domain d4h25e1: 4h25 E:6-92 [234612]
   Other proteins in same PDB: d4h25a1, d4h25a2, d4h25b2, d4h25b3, d4h25b4, d4h25d1, d4h25d2, d4h25e2, d4h25e3, d4h25e4
   automated match to d4h26e1
   complexed with ipa

Details for d4h25e1

PDB Entry: 4h25, 2.2 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insights to nickel contact allergy

PDB Compounds: (E:) MHC class II antigen

SCOPe Domain Sequences for d4h25e1:

Sequence; same for both SEQRES and ATOM records:

>d4h25e1 d.19.1.1 (E:6-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswnsqk
dlleqkrgqvdtycrhnygvvesftvq

Timeline for d4h25e1:

• d4h25e1 first appeared in SCOPe 2.03
  
• d4h25e1 appears in SCOPe 2.05
  
• d4h25e1 appears in the current release, SCOPe 2.07