Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
Protein automated matches [190133] (5 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [234554] (4 PDB entries) |
Domain d4h0ya2: 4h0y A:210-413 [234598] Other proteins in same PDB: d4h0yb1, d4h0yb2 automated match to d1giqa2 complexed with atp, ca, edo, lar, nad, po4 |
PDB Entry: 4h0y (more details), 1.94 Å
SCOPe Domain Sequences for d4h0ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0ya2 d.166.1.1 (A:210-413) automated matches {Clostridium perfringens [TaxId: 1502]} sldfkddvskgdlwgkenysdwsnkltpneladvndymrggytainnylisngplnnpnp eldskvnnienalkltpipsnlivyrrsgpqefgltltspeydfnkienidafkekwegk vitypnfistsigsvnmsafakrkiilrinipkdspgaylsaipgyageysvllnhgskf kinkvdsykdgtvtklildatlin
Timeline for d4h0ya2: