Lineage for d4h02g1 (4h02 G:80-228)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1315558Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1315559Protein automated matches [190576] (18 species)
    not a true protein
  7. Species Plasmodium falciparum [TaxId:36329] [234564] (1 PDB entry)
  8. 1315615Domain d4h02g1: 4h02 G:80-228 [234573]
    Other proteins in same PDB: d4h02a2, d4h02b2, d4h02c2, d4h02d2, d4h02e2, d4h02f2, d4h02g2, d4h02h2
    automated match to d3bjua1

Details for d4h02g1

PDB Entry: 4h02 (more details), 2.9 Å

PDB Description: crystal structure of p. falciparum lysyl-trna synthetase
PDB Compounds: (G:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d4h02g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h02g1 b.40.4.0 (G:80-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkyglk

SCOPe Domain Coordinates for d4h02g1:

Click to download the PDB-style file with coordinates for d4h02g1.
(The format of our PDB-style files is described here.)

Timeline for d4h02g1: