Lineage for d4gyva_ (4gyv A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275012Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 1275013Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 1275074Family a.87.1.0: automated matches [233075] (1 protein)
    not a true family
  6. 1275075Protein automated matches [233076] (2 species)
    not a true protein
  7. 1275081Species Mus musculus [TaxId:10090] [234557] (1 PDB entry)
  8. 1275082Domain d4gyva_: 4gyv A: [234562]
    automated match to d1by1a_

Details for d4gyva_

PDB Entry: 4gyv (more details), 2.9 Å

PDB Description: crystal structure of the dh domain of farp2
PDB Compounds: (A:) FERM, RhoGEF and pleckstrin domain-containing protein 2

SCOPe Domain Sequences for d4gyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gyva_ a.87.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
chealkaitevttelqqsltrlenlqkltelqrdlv

SCOPe Domain Coordinates for d4gyva_:

Click to download the PDB-style file with coordinates for d4gyva_.
(The format of our PDB-style files is described here.)

Timeline for d4gyva_: